WISP2 MaxPab rabbit polyclonal antibody (D01)
  • WISP2 MaxPab rabbit polyclonal antibody (D01)

WISP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008839-D01
WISP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WISP2 protein.
Información adicional
Size 100 uL
Gene Name WISP2
Gene Alias CCN5|CT58|CTGF-L
Gene Description WNT1 inducible signaling pathway protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IP
Immunogen Prot. Seq MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WISP2 (NP_003872.1, 1 a.a. ~ 250 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8839

Enviar uma mensagem


WISP2 MaxPab rabbit polyclonal antibody (D01)

WISP2 MaxPab rabbit polyclonal antibody (D01)