WISP3 purified MaxPab mouse polyclonal antibody (B01P)
  • WISP3 purified MaxPab mouse polyclonal antibody (B01P)

WISP3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008838-B01P
WISP3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human WISP3 protein.
Información adicional
Size 50 ug
Gene Name WISP3
Gene Alias CCN6|LIBC|MGC125987|MGC125988|MGC125989|PPAC|PPD
Gene Description WNT1 inducible signaling pathway protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNKRRLLYPSGWLHGPSDMQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCSLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGISNRVTNENSN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WISP3 (NP_937882.1, 1 a.a. ~ 372 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8838

Enviar uma mensagem


WISP3 purified MaxPab mouse polyclonal antibody (B01P)

WISP3 purified MaxPab mouse polyclonal antibody (B01P)