SOCS2 monoclonal antibody (M01), clone 3E7
  • SOCS2 monoclonal antibody (M01), clone 3E7

SOCS2 monoclonal antibody (M01), clone 3E7

Ref: AB-H00008835-M01
SOCS2 monoclonal antibody (M01), clone 3E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOCS2.
Información adicional
Size 100 ug
Gene Name SOCS2
Gene Alias CIS2|Cish2|SOCS-2|SSI-2|SSI2|STATI2
Gene Description suppressor of cytokine signaling 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq YQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOCS2 (AAH10399, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8835
Clone Number 3E7
Iso type IgG2a Kappa

Enviar uma mensagem


SOCS2 monoclonal antibody (M01), clone 3E7

SOCS2 monoclonal antibody (M01), clone 3E7