GMPS monoclonal antibody (M01), clone 1D10
  • GMPS monoclonal antibody (M01), clone 1D10

GMPS monoclonal antibody (M01), clone 1D10

Ref: AB-H00008833-M01
GMPS monoclonal antibody (M01), clone 1D10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GMPS.
Información adicional
Size 100 ug
Gene Name GMPS
Gene Alias -
Gene Description guanine monphosphate synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GMPS (NP_003866, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8833
Clone Number 1D10
Iso type IgG1 Kappa

Enviar uma mensagem


GMPS monoclonal antibody (M01), clone 1D10

GMPS monoclonal antibody (M01), clone 1D10