CD84 monoclonal antibody (M01), clone 3G10
  • CD84 monoclonal antibody (M01), clone 3G10

CD84 monoclonal antibody (M01), clone 3G10

Ref: AB-H00008832-M01
CD84 monoclonal antibody (M01), clone 3G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CD84.
Información adicional
Size 100 ug
Gene Name CD84
Gene Alias DKFZp781E2378|LY9B|SLAMF5|hCD84|mCD84
Gene Description CD84 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVISDLRMEDAGDYKADINTQADPYTTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD84 (NP_003865.1, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8832
Clone Number 3G10
Iso type IgG2b Kappa

Enviar uma mensagem


CD84 monoclonal antibody (M01), clone 3G10

CD84 monoclonal antibody (M01), clone 3G10