NRP1 monoclonal antibody (M05), clone 1B3
  • NRP1 monoclonal antibody (M05), clone 1B3

NRP1 monoclonal antibody (M05), clone 1B3

Ref: AB-H00008829-M05
NRP1 monoclonal antibody (M05), clone 1B3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NRP1.
Información adicional
Size 100 ug
Gene Name NRP1
Gene Alias BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R
Gene Description neuropilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NRP1 (NP_003864, 22 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8829
Clone Number 1B3
Iso type IgG2a Kappa

Enviar uma mensagem


NRP1 monoclonal antibody (M05), clone 1B3

NRP1 monoclonal antibody (M05), clone 1B3