NRP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NRP1 purified MaxPab rabbit polyclonal antibody (D01P)

NRP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008829-D01P
NRP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NRP1 protein.
Información adicional
Size 100 ug
Gene Name NRP1
Gene Alias BDCA4|CD304|DKFZp686A03134|DKFZp781F1414|NP1|NRP|VEGF165R
Gene Description neuropilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NRP1 (NP_001019800.1, 1 a.a. ~ 609 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8829

Enviar uma mensagem


NRP1 purified MaxPab rabbit polyclonal antibody (D01P)

NRP1 purified MaxPab rabbit polyclonal antibody (D01P)