NRP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • NRP2 purified MaxPab rabbit polyclonal antibody (D01P)

NRP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008828-D01P
NRP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NRP2 protein.
Información adicional
Size 100 ug
Gene Name NRP2
Gene Alias MGC126574|NP2|NPN2|PRO2714|VEGF165R2
Gene Description neuropilin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NRP2 (NP_003863.2, 1 a.a. ~ 926 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8828

Enviar uma mensagem


NRP2 purified MaxPab rabbit polyclonal antibody (D01P)

NRP2 purified MaxPab rabbit polyclonal antibody (D01P)