INPP4B monoclonal antibody (M03), clone 3F2
  • INPP4B monoclonal antibody (M03), clone 3F2

INPP4B monoclonal antibody (M03), clone 3F2

Ref: AB-H00008821-M03
INPP4B monoclonal antibody (M03), clone 3F2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant INPP4B.
Información adicional
Size 100 ug
Gene Name INPP4B
Gene Alias MGC132014
Gene Description inositol polyphosphate-4-phosphatase, type II, 105kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INPP4B (AAH05273, 1 a.a. ~ 53 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8821
Clone Number 3F2
Iso type IgG2b Kappa

Enviar uma mensagem


INPP4B monoclonal antibody (M03), clone 3F2

INPP4B monoclonal antibody (M03), clone 3F2