HESX1 monoclonal antibody (M01), clone 2C4
  • HESX1 monoclonal antibody (M01), clone 2C4

HESX1 monoclonal antibody (M01), clone 2C4

Ref: AB-H00008820-M01
HESX1 monoclonal antibody (M01), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HESX1.
Información adicional
Size 100 ug
Gene Name HESX1
Gene Alias ANF|MGC138294|RPX
Gene Description HESX homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HESX1 (NP_003856.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8820
Clone Number 2C4
Iso type IgG2b Kappa

Enviar uma mensagem


HESX1 monoclonal antibody (M01), clone 2C4

HESX1 monoclonal antibody (M01), clone 2C4