HESX1 purified MaxPab mouse polyclonal antibody (B01P)
  • HESX1 purified MaxPab mouse polyclonal antibody (B01P)

HESX1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008820-B01P
HESX1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HESX1 protein.
Información adicional
Size 50 ug
Gene Name HESX1
Gene Alias ANF|MGC138294|RPX
Gene Description HESX homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HESX1 (NP_003856.1, 1 a.a. ~ 185 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8820

Enviar uma mensagem


HESX1 purified MaxPab mouse polyclonal antibody (B01P)

HESX1 purified MaxPab mouse polyclonal antibody (B01P)