BANF1 monoclonal antibody (M07), clone M2
  • BANF1 monoclonal antibody (M07), clone M2

BANF1 monoclonal antibody (M07), clone M2

Ref: AB-H00008815-M07
BANF1 monoclonal antibody (M07), clone M2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant BANF1.
Información adicional
Size 100 ug
Gene Name BANF1
Gene Alias BAF|BCRP1|D14S1460|MGC111161
Gene Description barrier to autointegration factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8815
Clone Number M2
Iso type IgG2a Kappa

Enviar uma mensagem


BANF1 monoclonal antibody (M07), clone M2

BANF1 monoclonal antibody (M07), clone M2