CDKL1 monoclonal antibody (M05), clone 2H6
  • CDKL1 monoclonal antibody (M05), clone 2H6

CDKL1 monoclonal antibody (M05), clone 2H6

Ref: AB-H00008814-M05
CDKL1 monoclonal antibody (M05), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDKL1.
Información adicional
Size 100 ug
Gene Name CDKL1
Gene Alias KKIALRE|p42
Gene Description cyclin-dependent kinase-like 1 (CDC2-related kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8814
Clone Number 2H6
Iso type IgG2a Kappa

Enviar uma mensagem


CDKL1 monoclonal antibody (M05), clone 2H6

CDKL1 monoclonal antibody (M05), clone 2H6