CDKL1 monoclonal antibody (M02A), clone 8B2
  • CDKL1 monoclonal antibody (M02A), clone 8B2

CDKL1 monoclonal antibody (M02A), clone 8B2

Ref: AB-H00008814-M02A
CDKL1 monoclonal antibody (M02A), clone 8B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDKL1.
Información adicional
Size 200 uL
Gene Name CDKL1
Gene Alias KKIALRE|p42
Gene Description cyclin-dependent kinase-like 1 (CDC2-related kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 8814
Clone Number 8B2
Iso type IgG2b Kappa

Enviar uma mensagem


CDKL1 monoclonal antibody (M02A), clone 8B2

CDKL1 monoclonal antibody (M02A), clone 8B2