CDKL1 polyclonal antibody (A01)
  • CDKL1 polyclonal antibody (A01)

CDKL1 polyclonal antibody (A01)

Ref: AB-H00008814-A01
CDKL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDKL1.
Información adicional
Size 50 uL
Gene Name CDKL1
Gene Alias KKIALRE|p42
Gene Description cyclin-dependent kinase-like 1 (CDC2-related kinase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNYRFPNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8814

Enviar uma mensagem


CDKL1 polyclonal antibody (A01)

CDKL1 polyclonal antibody (A01)