IL1RL2 monoclonal antibody (M01), clone 5G5
  • IL1RL2 monoclonal antibody (M01), clone 5G5

IL1RL2 monoclonal antibody (M01), clone 5G5

Ref: AB-H00008808-M01
IL1RL2 monoclonal antibody (M01), clone 5G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL1RL2.
Información adicional
Size 100 ug
Gene Name IL1RL2
Gene Alias IL1R-rp2|IL1RRP2
Gene Description interleukin 1 receptor-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL1RL2 (NP_003845, 20 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8808
Clone Number 5G5
Iso type IgG1 Kappa

Enviar uma mensagem


IL1RL2 monoclonal antibody (M01), clone 5G5

IL1RL2 monoclonal antibody (M01), clone 5G5