CREG1 monoclonal antibody (M01), clone 1B7
  • CREG1 monoclonal antibody (M01), clone 1B7

CREG1 monoclonal antibody (M01), clone 1B7

Ref: AB-H00008804-M01
CREG1 monoclonal antibody (M01), clone 1B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CREG1.
Información adicional
Size 100 ug
Gene Name CREG1
Gene Alias CREG
Gene Description cellular repressor of E1A-stimulated genes 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVTPEEYYNVTVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREG1 (NP_003842, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8804
Clone Number 1B7
Iso type IgG1 Kappa

Enviar uma mensagem


CREG1 monoclonal antibody (M01), clone 1B7

CREG1 monoclonal antibody (M01), clone 1B7