CREG1 polyclonal antibody (A01)
  • CREG1 polyclonal antibody (A01)

CREG1 polyclonal antibody (A01)

Ref: AB-H00008804-A01
CREG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CREG1.
Información adicional
Size 50 uL
Gene Name CREG1
Gene Alias CREG
Gene Description cellular repressor of E1A-stimulated genes 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVTPEEYYNVTVQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CREG1 (NP_003842, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8804

Enviar uma mensagem


CREG1 polyclonal antibody (A01)

CREG1 polyclonal antibody (A01)