DYRK4 monoclonal antibody (M04), clone 3B9
  • DYRK4 monoclonal antibody (M04), clone 3B9

DYRK4 monoclonal antibody (M04), clone 3B9

Ref: AB-H00008798-M04
DYRK4 monoclonal antibody (M04), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DYRK4.
Información adicional
Size 100 ug
Gene Name DYRK4
Gene Alias -
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq FFPSETRKDKVQGCHHSSRKADEITKETTEKTKDSPTKHVQHSGDQQDCLQHGADTVQLPQLVDAPKKSEAAVGAEVSMTSPGQSKNFSLKNTNVLPPIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DYRK4 (AAH31244, 421 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8798
Clone Number 3B9
Iso type IgG2a Kappa

Enviar uma mensagem


DYRK4 monoclonal antibody (M04), clone 3B9

DYRK4 monoclonal antibody (M04), clone 3B9