DYRK4 purified MaxPab rabbit polyclonal antibody (D01P)
  • DYRK4 purified MaxPab rabbit polyclonal antibody (D01P)

DYRK4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008798-D01P
DYRK4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human DYRK4 protein.
Información adicional
Size 100 ug
Gene Name DYRK4
Gene Alias -
Gene Description dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPASELKASEIPFHPSIKTQDPKAEEKSPKKQKVTLTAAEALKLFKNQLSPYEQSEILGYAELWFLGLEAKKLDTAPEKFSKTSFDDEHGFYLKVLHDHIAYRYEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DYRK4 (NP_003836.1, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8798

Enviar uma mensagem


DYRK4 purified MaxPab rabbit polyclonal antibody (D01P)

DYRK4 purified MaxPab rabbit polyclonal antibody (D01P)