SCEL purified MaxPab mouse polyclonal antibody (B01P)
  • SCEL purified MaxPab mouse polyclonal antibody (B01P)

SCEL purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008796-B01P
SCEL purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SCEL protein.
Información adicional
Size 50 ug
Gene Name SCEL
Gene Alias FLJ21667|MGC22531
Gene Description sciellin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYSSDDTLDRISDRNDAAKTYKANTLDNQLTNRSMSVFRSLEVTKLQPGGSLNANTSNTIASTSATTPVKKKRQSWFPPPPPGYNASSSTGTRRREPGVHPPIPPKPSSPVSSTNQLRQDNRQIHPPKPGVYTETNRSAERNISEELDNLIKMNKSLNRNQGLDSLFR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCEL (AAH47536.1, 1 a.a. ~ 668 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8796

Enviar uma mensagem


SCEL purified MaxPab mouse polyclonal antibody (B01P)

SCEL purified MaxPab mouse polyclonal antibody (B01P)