FPGT polyclonal antibody (A01)
  • FPGT polyclonal antibody (A01)

FPGT polyclonal antibody (A01)

Ref: AB-H00008790-A01
FPGT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant FPGT.
Información adicional
Size 50 uL
Gene Name FPGT
Gene Alias GFPP
Gene Description fucose-1-phosphate guanylyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAARDPPEVSLREATQRKLRRFSELRGKLVARGEFWDIVAITAADEKQELAYNQQLSEKLKRKELPLGVQYHVFVDPAGAKIGNGGSTLCALQCLEKLYGDKWNSFTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FPGT (NP_003829, 1 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8790

Enviar uma mensagem


FPGT polyclonal antibody (A01)

FPGT polyclonal antibody (A01)