FBP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • FBP2 purified MaxPab rabbit polyclonal antibody (D01P)

FBP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008789-D01P
FBP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FBP2 protein.
Información adicional
Size 100 ug
Gene Name FBP2
Gene Alias MGC142192
Gene Description fructose-1,6-bisphosphatase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FBP2 (NP_003828.2, 1 a.a. ~ 339 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8789

Enviar uma mensagem


FBP2 purified MaxPab rabbit polyclonal antibody (D01P)

FBP2 purified MaxPab rabbit polyclonal antibody (D01P)