FADD purified MaxPab rabbit polyclonal antibody (D01P)
  • FADD purified MaxPab rabbit polyclonal antibody (D01P)

FADD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008772-D01P
FADD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FADD protein.
Información adicional
Size 100 ug
Gene Name FADD
Gene Alias GIG3|MGC8528|MORT1
Gene Description Fas (TNFRSF6)-associated via death domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FADD (NP_003815.1, 1 a.a. ~ 208 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8772

Enviar uma mensagem


FADD purified MaxPab rabbit polyclonal antibody (D01P)

FADD purified MaxPab rabbit polyclonal antibody (D01P)