PABPC4 purified MaxPab mouse polyclonal antibody (B01P)
  • PABPC4 purified MaxPab mouse polyclonal antibody (B01P)

PABPC4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008761-B01P
PABPC4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PABPC4 protein.
Información adicional
Size 50 ug
Gene Name PABPC4
Gene Alias APP-1|APP1|FLJ43938|PABP4|iPABP
Gene Description poly(A) binding protein, cytoplasmic 4 (inducible form)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSVKVMRDPNGKSKGFGFVSYEKHEDANKAVEEMNGKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PABPC4 (AAH71591.1, 1 a.a. ~ 660 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8761

Enviar uma mensagem


PABPC4 purified MaxPab mouse polyclonal antibody (B01P)

PABPC4 purified MaxPab mouse polyclonal antibody (B01P)