CDS2 monoclonal antibody (M01), clone 2B9
  • CDS2 monoclonal antibody (M01), clone 2B9

CDS2 monoclonal antibody (M01), clone 2B9

Ref: AB-H00008760-M01
CDS2 monoclonal antibody (M01), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CDS2.
Información adicional
Size 100 ug
Gene Name CDS2
Gene Alias FLJ38111
Gene Description CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDS2 (NP_003809, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8760
Clone Number 2B9
Iso type IgG1 Kappa

Enviar uma mensagem


CDS2 monoclonal antibody (M01), clone 2B9

CDS2 monoclonal antibody (M01), clone 2B9