TNFSF9 polyclonal antibody (A01)
  • TNFSF9 polyclonal antibody (A01)

TNFSF9 polyclonal antibody (A01)

Ref: AB-H00008744-A01
TNFSF9 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TNFSF9.
Información adicional
Size 50 uL
Gene Name TNFSF9
Gene Alias 4-1BB-L|CD137L
Gene Description tumor necrosis factor (ligand) superfamily, member 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TNFSF9 (NP_003802, 145 a.a. ~ 254 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8744

Enviar uma mensagem


TNFSF9 polyclonal antibody (A01)

TNFSF9 polyclonal antibody (A01)