TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)
  • TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)

TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008742-B01P
TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TNFSF12 protein.
Información adicional
Size 50 ug
Gene Name TNFSF12
Gene Alias APO3L|DR3LG|MGC129581|MGC20669|TWEAK
Gene Description tumor necrosis factor (ligand) superfamily, member 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TNFSF12 (AAH71837.1, 1 a.a. ~ 134 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8742

Enviar uma mensagem


TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)

TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)