RIPK1 polyclonal antibody (A01)
  • RIPK1 polyclonal antibody (A01)

RIPK1 polyclonal antibody (A01)

Ref: AB-H00008737-A01
RIPK1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RIPK1.
Información adicional
Size 50 uL
Gene Name RIPK1
Gene Alias FLJ39204|RIP|RIP1
Gene Description receptor (TNFRSF)-interacting serine-threonine kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RIPK1 (NP_003795, 562 a.a. ~ 671 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8737

Enviar uma mensagem


RIPK1 polyclonal antibody (A01)

RIPK1 polyclonal antibody (A01)