CTNNAL1 MaxPab rabbit polyclonal antibody (D01)
  • CTNNAL1 MaxPab rabbit polyclonal antibody (D01)

CTNNAL1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00008727-D01
CTNNAL1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CTNNAL1 protein.
Información adicional
Size 100 uL
Gene Name CTNNAL1
Gene Alias CLLP|FLJ08121|alpha-CATU
Gene Description catenin (cadherin-associated protein), alpha-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAASPGPAGVGGAGAVYGSGSSGFALDSGLEIKTRSVEQTLLPLVSQITTLINHKDNTKKSDKTLQAIQRVGQAVNLAVGRFVKVGEAIANENWDLKEEINIACIEAKQAGETIAALTDITNLNHLESDGQITIFTDKTGVIKAARLLLSSVTKVLLLADRVVIKQIITSRNKVLATMERLEKVNSFQEFVQIFSQFGNEMVEFAHLSGDRQNDLKDEKKKAKMAAARAVLEKCTMMLLTASKTCLRHPNCESAH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CTNNAL1 (NP_003789.1, 1 a.a. ~ 734 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 8727

Enviar uma mensagem


CTNNAL1 MaxPab rabbit polyclonal antibody (D01)

CTNNAL1 MaxPab rabbit polyclonal antibody (D01)