CTNNAL1 polyclonal antibody (A01)
  • CTNNAL1 polyclonal antibody (A01)

CTNNAL1 polyclonal antibody (A01)

Ref: AB-H00008727-A01
CTNNAL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CTNNAL1.
Información adicional
Size 50 uL
Gene Name CTNNAL1
Gene Alias CLLP|FLJ08121|alpha-CATU
Gene Description catenin (cadherin-associated protein), alpha-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TDCKPNGETDISSISIFTGIKEFKMNIEALRENLYFQSKENLSVTLEVILERMEDFTDSAYTSHEHRERILELSTQARMELQQLISVWIQAQSKKTKSIAEELE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CTNNAL1 (NP_003789, 277 a.a. ~ 380 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8727

Enviar uma mensagem


CTNNAL1 polyclonal antibody (A01)

CTNNAL1 polyclonal antibody (A01)