MBTPS1 monoclonal antibody (M07), clone 2E6
  • MBTPS1 monoclonal antibody (M07), clone 2E6

MBTPS1 monoclonal antibody (M07), clone 2E6

Ref: AB-H00008720-M07
MBTPS1 monoclonal antibody (M07), clone 2E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MBTPS1.
Información adicional
Size 100 ug
Gene Name MBTPS1
Gene Alias KIAA0091|MGC138711|MGC138712|PCSK8|S1P|SKI-1
Gene Description membrane-bound transcription factor peptidase, site 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq GLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MBTPS1 (NP_957720.1, 246 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8720
Clone Number 2E6
Iso type IgG1 Kappa

Enviar uma mensagem


MBTPS1 monoclonal antibody (M07), clone 2E6

MBTPS1 monoclonal antibody (M07), clone 2E6