TRADD purified MaxPab rabbit polyclonal antibody (D01P)
  • TRADD purified MaxPab rabbit polyclonal antibody (D01P)

TRADD purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008717-D01P
TRADD purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRADD protein.
Información adicional
Size 100 ug
Gene Name TRADD
Gene Alias Hs.89862|MGC11078
Gene Description TNFRSF1A-associated via death domain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRADD (NP_003780.1, 1 a.a. ~ 312 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8717

Enviar uma mensagem


TRADD purified MaxPab rabbit polyclonal antibody (D01P)

TRADD purified MaxPab rabbit polyclonal antibody (D01P)