NOL4 monoclonal antibody (M01), clone 2A10
  • NOL4 monoclonal antibody (M01), clone 2A10

NOL4 monoclonal antibody (M01), clone 2A10

Ref: AB-H00008715-M01
NOL4 monoclonal antibody (M01), clone 2A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NOL4.
Información adicional
Size 100 ug
Gene Name NOL4
Gene Alias HRIHFB2255|NOLP
Gene Description nucleolar protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq PGSQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NOL4 (NP_003778, 425 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8715
Clone Number 2A10
Iso type IgG2a Kappa

Enviar uma mensagem


NOL4 monoclonal antibody (M01), clone 2A10

NOL4 monoclonal antibody (M01), clone 2A10