B3GALT2 monoclonal antibody (M03), clone 1D9
  • B3GALT2 monoclonal antibody (M03), clone 1D9

B3GALT2 monoclonal antibody (M03), clone 1D9

Ref: AB-H00008707-M03
B3GALT2 monoclonal antibody (M03), clone 1D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant B3GALT2.
Información adicional
Size 100 ug
Gene Name B3GALT2
Gene Alias BETA3GALT2|GLCT2|beta3Gal-T2
Gene Description UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen B3GALT2 (NP_003774, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8707
Clone Number 1D9
Iso type IgG2a Kappa

Enviar uma mensagem


B3GALT2 monoclonal antibody (M03), clone 1D9

B3GALT2 monoclonal antibody (M03), clone 1D9