HYAL2 polyclonal antibody (A01)
  • HYAL2 polyclonal antibody (A01)

HYAL2 polyclonal antibody (A01)

Ref: AB-H00008692-A01
HYAL2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HYAL2.
Información adicional
Size 50 uL
Gene Name HYAL2
Gene Alias LUCA2|LuCa-2
Gene Description hyaluronoglucosaminidase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HYAL2 (NP_003764, 340 a.a. ~ 439 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8692

Enviar uma mensagem


HYAL2 polyclonal antibody (A01)

HYAL2 polyclonal antibody (A01)