SLC4A4 polyclonal antibody (A01)
  • SLC4A4 polyclonal antibody (A01)

SLC4A4 polyclonal antibody (A01)

Ref: AB-H00008671-A01
SLC4A4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC4A4.
Información adicional
Size 50 uL
Gene Name SLC4A4
Gene Alias DKFZp781H1314|HNBC1|KNBC|NBC1|NBC2|SLC4A5|hhNMC|pNBC
Gene Description solute carrier family 4, sodium bicarbonate cotransporter, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC4A4 (NP_003750, 121 a.a. ~ 229 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8671

Enviar uma mensagem


SLC4A4 polyclonal antibody (A01)

SLC4A4 polyclonal antibody (A01)