EIF3S3 monoclonal antibody (M01), clone 3B12
  • EIF3S3 monoclonal antibody (M01), clone 3B12

EIF3S3 monoclonal antibody (M01), clone 3B12

Ref: AB-H00008667-M01
EIF3S3 monoclonal antibody (M01), clone 3B12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EIF3S3.
Información adicional
Size 100 ug
Gene Name EIF3H
Gene Alias EIF3S3|MGC102958|eIF3-gamma|eIF3-p40
Gene Description eukaryotic translation initiation factor 3, subunit H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEALKKANITFEYMFEEVPIVIKNSHLINVLMWELEKKSAVADKHELLSLASSNHLGKNLQLLMDRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF3S3 (NP_003747, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8667
Clone Number 3B12
Iso type IgG2a Kappa

Enviar uma mensagem


EIF3S3 monoclonal antibody (M01), clone 3B12

EIF3S3 monoclonal antibody (M01), clone 3B12