EIF3S5 polyclonal antibody (A01)
  • EIF3S5 polyclonal antibody (A01)

EIF3S5 polyclonal antibody (A01)

Ref: AB-H00008665-A01
EIF3S5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF3S5.
Información adicional
Size 50 uL
Gene Name EIF3F
Gene Alias EIF3S5|eIF3-p47
Gene Description eukaryotic translation initiation factor 3, subunit F
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq SPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF3S5 (NP_003745, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8665

Enviar uma mensagem


EIF3S5 polyclonal antibody (A01)

EIF3S5 polyclonal antibody (A01)