EIF3S8 purified MaxPab mouse polyclonal antibody (B01P)
  • EIF3S8 purified MaxPab mouse polyclonal antibody (B01P)

EIF3S8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00008663-B01P
EIF3S8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human EIF3S8 protein.
Información adicional
Size 50 ug
Gene Name EIF3C
Gene Alias EIF3S8|FLJ78287|MGC189744|eIF3-p110
Gene Description eukaryotic translation initiation factor 3, subunit C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNAMKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALSTLRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRKFLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF3S8 (NP_003743.1, 1 a.a. ~ 913 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8663

Enviar uma mensagem


EIF3S8 purified MaxPab mouse polyclonal antibody (B01P)

EIF3S8 purified MaxPab mouse polyclonal antibody (B01P)