EIF3A monoclonal antibody (M02), clone 2G4
  • EIF3A monoclonal antibody (M02), clone 2G4

EIF3A monoclonal antibody (M02), clone 2G4

Ref: AB-H00008661-M02
EIF3A monoclonal antibody (M02), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EIF3A.
Información adicional
Size 100 ug
Gene Name EIF3A
Gene Alias EIF3|EIF3S10|KIAA0139|P167|TIF32|eIF3-p170|eIF3-theta|p180|p185
Gene Description eukaryotic translation initiation factor 3, subunit A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF3A (NP_003741, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8661
Clone Number 2G4
Iso type IgG2a Kappa

Enviar uma mensagem


EIF3A monoclonal antibody (M02), clone 2G4

EIF3A monoclonal antibody (M02), clone 2G4