Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ALDH4A1 polyclonal antibody (A01)
Abnova
ALDH4A1 polyclonal antibody (A01)
Ref: AB-H00008659-A01
ALDH4A1 polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length recombinant ALDH4A1.
Información adicional
Size
50 uL
Gene Name
ALDH4A1
Gene Alias
ALDH4|P5CD|P5CDh|P5CDhL|P5CDhS
Gene Description
aldehyde dehydrogenase 4 family, member A1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGDEEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ALDH4A1 (AAH07581, 1 a.a. ~ 563 a.a) full-length recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
8659
Enviar uma mensagem
ALDH4A1 polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*