DYNLL1 monoclonal antibody (M02), clone 1H7
  • DYNLL1 monoclonal antibody (M02), clone 1H7

DYNLL1 monoclonal antibody (M02), clone 1H7

Ref: AB-H00008655-M02
DYNLL1 monoclonal antibody (M02), clone 1H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DYNLL1.
Información adicional
Size 100 ug
Gene Name DYNLL1
Gene Alias DLC1|DLC8|DNCL1|DNCLC1|LC8|LC8a|MGC126137|MGC126138|PIN|hdlc1
Gene Description dynein, light chain, LC8-type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DYNLL1 (NP_003737.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8655
Clone Number 1H7
Iso type IgG2a Kappa

Enviar uma mensagem


DYNLL1 monoclonal antibody (M02), clone 1H7

DYNLL1 monoclonal antibody (M02), clone 1H7