NUMB purified MaxPab mouse polyclonal antibody (B04P)
  • NUMB purified MaxPab mouse polyclonal antibody (B04P)

NUMB purified MaxPab mouse polyclonal antibody (B04P)

Ref: AB-H00008650-B04P
NUMB purified MaxPab mouse polyclonal antibody (B04P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NUMB protein.
Información adicional
Size 50 ug
Gene Name NUMB
Gene Alias S171
Gene Description numb homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUMB (AAH33824.1, 1 a.a. ~ 135 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8650

Enviar uma mensagem


NUMB purified MaxPab mouse polyclonal antibody (B04P)

NUMB purified MaxPab mouse polyclonal antibody (B04P)