KCNK5 monoclonal antibody (M05), clone 2B4 View larger

Mouse monoclonal antibody raised against a full length recombinant KCNK5.

AB-H00008645-M05

New product

KCNK5 monoclonal antibody (M05), clone 2B4

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name KCNK5
Gene Alias FLJ11035|K2p5.1|TASK-2|TASK2
Gene Description potassium channel, subfamily K, member 5
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKILEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFGVPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSLFVNWKVSMFVEVHKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KCNK5 (AAH60793, 1 a.a. ~ 499 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8645
Clone Number 2B4
Iso type IgG1 Kappa

More info

Mouse monoclonal antibody raised against a full length recombinant KCNK5.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant KCNK5.

Mouse monoclonal antibody raised against a full length recombinant KCNK5.