AKR1C3 purified MaxPab rabbit polyclonal antibody (D01P)
  • AKR1C3 purified MaxPab rabbit polyclonal antibody (D01P)

AKR1C3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00008644-D01P
AKR1C3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human AKR1C3 protein.
Información adicional
Size 100 ug
Gene Name AKR1C3
Gene Alias DD3|DDX|HA1753|HAKRB|HAKRe|HSD17B5|KIAA0119|hluPGFS
Gene Description aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AKR1C3 (NP_003730.4, 1 a.a. ~ 323 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8644

Enviar uma mensagem


AKR1C3 purified MaxPab rabbit polyclonal antibody (D01P)

AKR1C3 purified MaxPab rabbit polyclonal antibody (D01P)