EIF4EBP3 monoclonal antibody (M05), clone 4C1
  • EIF4EBP3 monoclonal antibody (M05), clone 4C1

EIF4EBP3 monoclonal antibody (M05), clone 4C1

Ref: AB-H00008637-M05
EIF4EBP3 monoclonal antibody (M05), clone 4C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EIF4EBP3.
Información adicional
Size 100 ug
Gene Name EIF4EBP3
Gene Alias 4E-BP3
Gene Description eukaryotic translation initiation factor 4E binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4EBP3 (NP_003723, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8637
Clone Number 4C1
Iso type IgG2a Kappa

Enviar uma mensagem


EIF4EBP3 monoclonal antibody (M05), clone 4C1

EIF4EBP3 monoclonal antibody (M05), clone 4C1