EIF4EBP3 polyclonal antibody (A01)
  • EIF4EBP3 polyclonal antibody (A01)

EIF4EBP3 polyclonal antibody (A01)

Ref: AB-H00008637-A01
EIF4EBP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EIF4EBP3.
Información adicional
Size 50 uL
Gene Name EIF4EBP3
Gene Alias 4E-BP3
Gene Description eukaryotic translation initiation factor 4E binding protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4EBP3 (NP_003723, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8637

Enviar uma mensagem


EIF4EBP3 polyclonal antibody (A01)

EIF4EBP3 polyclonal antibody (A01)