SCAP1 monoclonal antibody (M01), clone 3D3
  • SCAP1 monoclonal antibody (M01), clone 3D3

SCAP1 monoclonal antibody (M01), clone 3D3

Ref: AB-H00008631-M01
SCAP1 monoclonal antibody (M01), clone 3D3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SCAP1.
Información adicional
Size 100 ug
Gene Name SKAP1
Gene Alias SCAP1|SKAP55
Gene Description src kinase associated phosphoprotein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCAP1 (AAH47870, 1 a.a. ~ 358 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 8631
Clone Number 3D3
Iso type IgG2a Kappa

Enviar uma mensagem


SCAP1 monoclonal antibody (M01), clone 3D3

SCAP1 monoclonal antibody (M01), clone 3D3