PPAP2B polyclonal antibody (A01)
  • PPAP2B polyclonal antibody (A01)

PPAP2B polyclonal antibody (A01)

Ref: AB-H00008613-A01
PPAP2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PPAP2B.
Información adicional
Size 50 uL
Gene Name PPAP2B
Gene Alias Dri42|LPP3|MGC15306|PAP-2b|PAP2-b|PAP2-beta|VCIP
Gene Description phosphatidic acid phosphatase type 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPAP2B (AAH09196, 1 a.a. ~ 311 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 8613

Enviar uma mensagem


PPAP2B polyclonal antibody (A01)

PPAP2B polyclonal antibody (A01)